USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Default Default
0 items
New Products
Product Details
Thank You Vets Tablerunner
Thank You Vets Tablerunner
Thank You Vets Tablerunner
Thank You Vets Tablerunner
Product Code:1f60zHD
Product Condition:New
$16.00 inc. tax
Add to Cart
Description
Say Thank You to the veterans who have defended our freedoms with this tablerunner.

100% of the price of this item will be donated to Charity.
Updating Order Details
Please do not refresh or navigate away from the page!
Want to Support Me?
Buy me a Cup of Tea
Affiliate Links*:
Electric Quilt:   When I want to design a quilt, I go to EQ8 first.  It lets me design, try out fabrics and even calculates yardage for me.
Cricut:   Coming soon -- new affiliate program 

*please note, I receive a commission from purchases of these products.
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i