USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Default Default
0 items
New Products
Product Details
Red/White YoYo Coasters - Set of 4
Red/White YoYo Coasters - Set of 4
Product Code:12tZIaA
Product Condition:New
$12.00 inc. tax
Add to Cart
Description
Red and white yo yo coasters

Custom Orders welcome. Please allow 2 months lead time for custom orders. Please choose from the given options.
Updating Order Details
Please do not refresh or navigate away from the page!
Want to Support Me?
Buy me a Cup of Tea
Affiliate Links*:
Electric Quilt:   When I want to design a quilt, I go to EQ8 first.  It lets me design, try out fabrics and even calculates yardage for me.
Cricut:   Coming soon -- new affiliate program 

*please note, I receive a commission from purchases of these products.
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i