USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Default Default
0 items
New Products
Product Details
Save the Bees Wallhanging
Save the Bees Wallhanging
Save the Bees Wallhanging
Save the Bees Wallhanging
Product Code:ZksTQ9r
Product Condition:New
$24.00
Add to Cart
Updating Order Details
Please do not refresh or navigate away from the page!
Description
Show your support for the Bees with this wonderful wall hanging. The centerpeice has the Rules of the Hive. It is surrounding by bees, honeycombs and rules to live by.
Want to Support Me?
Buy me a Cup of Tea
Affiliate Links*:
Electric Quilt:   When I want to design a quilt, I go to EQ8 first.  It lets me design, try out fabrics and even calculates yardage for me.
Cricut:   Coming soon -- new affiliate program 

*please note, I receive a commission from purchases of these products.
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i